Free U.S. Shipping on Orders Over $150 | Same-Day Dispatch for Orders Placed Before 1 PM PST

Cagrilintide 10mg
$150.00
Cagrilintide lyophilized peptide. Not for human use.
Cagrilintide | 10mg
For In Vitro Research Use Only – Not for Human or Veterinary Application
Specifications:
- Quantity: 10mg
- Form: Lyophilized Powder
- Sequence: XKCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP-NH₂ (where “X” represents the eicosanedioic-acid-γ-Glu acyl group)
- Molecular Weight: ~4409 g/mol
- Purity: ≥99% (HPLC verified)
Intended Use:
This product is strictly for in vitro research conducted by qualified laboratories. It is not for human or veterinary use, and must not be used in food, cosmetics, drugs, or diagnostics.
Disclaimer:
This compound has not been evaluated by the FDA. It is not intended to diagnose, treat, cure, or prevent any disease. All research must comply with applicable laws and institutional protocols.
Terms of Sale:
Purchasing from us certifies that the buyer is a trained professional or licensed researcher. All sales are final. The buyer assumes full responsibility for lawful handling, usage, and storage.





Reviews
There are no reviews yet.